DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxl1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_957278.1 Gene:foxl1 / 393959 ZFINID:ZDB-GENE-040426-1181 Length:363 Species:Danio rerio


Alignment Length:320 Identity:82/320 - (25%)
Similarity:124/320 - (38%) Gaps:92/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EKPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRNRK 205
            :|||::|..:|.|| ::|.   |.||..:..:|..:|.::...|: |.|||||||||:.||....
Zfish    51 QKPPYSYIALIAMA-IKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVP 114

  Fly   206 REE--RGKGGYWELGVD-------------PKKCDRKRIRNRKIFHPTQNQTA-KL----QYEHL 250
            ||:  .|||.||.|...             .:||..:...:.|:.|.....|: ||    |.|.:
Zfish   115 REKGRPGKGSYWTLDTKCLDMFENGNYRRRKRKCRTQDTGDTKVGHKRTRVTSFKLHQGAQSEKV 179

  Fly   251 TEIQQAKSARKNHSRHIKKSKTSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKK 315
            :.::|      |..|.||:....:.|:..|           .|:|.|:         .||..|..
Zfish   180 SPLKQ------NPGRDIKEKSNDTQPQNEE-----------ENVASES---------AKDWCLAS 218

  Fly   316 KSELDTIVSSTESFLTESQNLNCFNSHKTDT-------TNTPISAEKNFCTFNNFYSEMTPVLAS 373
            .:   ||||..          .|....::.|       |:||:|:.          ||....:.|
Zfish   219 ST---TIVSLP----------RCTTPERSSTVSTVAVNTHTPLSSA----------SETRVPVKS 260

  Fly   374 NSNIVEDQNVSTDVSWPSHPCNITINYDYTNFQPIVDSIAEQFQ--CLH------DSAGY 425
            ::...:..:..   |..|:|...|......:...|:.....|||  |..      ||.||
Zfish   261 DTGRAQSGDAK---SKESNPRKTTDKAKEFSIDSILSKKENQFQRRCAAAGGASVDSRGY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/76 (43%)
foxl1NP_957278.1 FH 52..140 CDD:214627 34/88 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.