DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxi3b

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_944600.1 Gene:foxi3b / 387258 ZFINID:ZDB-GENE-031126-4 Length:383 Species:Danio rerio


Alignment Length:278 Identity:69/278 - (24%)
Similarity:109/278 - (39%) Gaps:98/278 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAM--LQNGRITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN--RK 205
            :||::||.:|.||:  ....|:||.|:..::...|.|:...|. |.|||||||||:.||:.  |.
Zfish   130 RPPYSYSALIAMAIHGAPERRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRD 194

  Fly   206 REERGKGGYWELGVDPKKCDRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHSRHIKKS 270
            .::.|||.||.|  || .|:       |:|.                        ..:.|..:|.
Zfish   195 EDDPGKGNYWTL--DP-NCE-------KMFD------------------------NGNFRRKRKR 225

  Fly   271 KTSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVSSTESFLTESQN 335
            |:.||||.|.:.         .|.:.:::|:.           ..||:...|.:|.|.       
Zfish   226 KSDSLPEKSSSG---------GNESGDSNGRG-----------SPKSQSIDISTSPEK------- 263

  Fly   336 LNCFNSHKTDTTNTPISAEKNFCTFNNFYSEMTPVLASNSNIVEDQNVSTDVSWP-SHPCNITIN 399
                       ..:|.|...:.| .:||.:||:.|.|.:.::..|         | |.|..:::.
Zfish   264 -----------GPSPASTGPSPC-LSNFLTEMSGVAAGSLDMEAD---------PLSRPFTLSLP 307

  Fly   400 YD----------YTNFQP 407
            .|          ::.|.|
Zfish   308 VDGAQRASQTTGFSTFTP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 32/75 (43%)
foxi3bNP_944600.1 FH 130..218 CDD:214627 38/121 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.