DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxi3a

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_944599.2 Gene:foxi3a / 387257 ZFINID:ZDB-GENE-031126-3 Length:353 Species:Danio rerio


Alignment Length:267 Identity:66/267 - (24%)
Similarity:106/267 - (39%) Gaps:89/267 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAM--LQNGRITLQQLCSWIEAKFAFFRVRK-KWNNSIRHNLSLHHCFRNRKRE 207
            :||::||.:|.||:  ..|.|:||.|:..::...|.|:...| .|.|||||||||:.||....|:
Zfish   116 RPPYSYSALIAMAIHGAPNRRLTLSQIYQYVADNFPFYNKSKASWQNSIRHNLSLNDCFMKVPRD 180

  Fly   208 ER--GKGGYWELGVDPKKCDRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHSRHIKKS 270
            :.  |||.||.|  || .|:       |:|.                        ..:.|..:|.
Zfish   181 DSDPGKGNYWTL--DP-NCE-------KMFD------------------------NGNFRRKRKR 211

  Fly   271 KTSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVSSTESFLTESQN 335
            |:.||.|                  :|..|                      .|.::|.|:..:|
Zfish   212 KSDSLAE------------------EEGKG----------------------YSGSDSALSSPKN 236

  Fly   336 LNCFNSHKTDTTNTPISAEKNFCTFNNFYSEMTPVLASNSNIVEDQNVSTDVSWPSHPCNITINY 400
                .|..::..|:|||.::..| .|:|.::|..|.:.:...:....::..:|..|.|..:    
Zfish   237 ----PSDSSERGNSPISTDQAPC-LNSFLNQMGDVASGSREALLPSPLAVPLSQRSSPTGV---- 292

  Fly   401 DYTNFQP 407
             |.::.|
Zfish   293 -YGSYSP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/75 (44%)
foxi3aNP_944599.2 FH 116..204 CDD:214627 39/121 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.