DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and fd59A

DIOPT Version :10

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster


Alignment Length:109 Identity:41/109 - (37%)
Similarity:62/109 - (56%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE 207
            |||::|..:|.||:||  :.::||..:|.:|.::|.:::.: ..|.|||||||||:.||....||
  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149

  Fly   208 --ERGKGGYWELGVDPKKCD--------RKRIRNRKIFHPTQNQ 241
              ..|||.:|.|  ||...|        |:|.|.::.  ||..:
  Fly   150 PGNPGKGNFWTL--DPLAEDMFDNGSFLRRRKRYKRA--PTMQR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 Forkhead 146..217 CDD:459732 32/75 (43%)
fd59ANP_523814.1 FH_FOXD4-like 85..180 CDD:410822 38/96 (40%)

Return to query results.
Submit another query.