DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxl2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_003750619.1 Gene:Foxl2 / 367152 RGDID:1310041 Length:374 Species:Rattus norvegicus


Alignment Length:109 Identity:46/109 - (42%)
Similarity:62/109 - (56%) Gaps:16/109 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DVTEKPPFNYSHIIGMAMLQNG--RITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN 203
            |..:|||::|..:|.||:.::.  |:||..:..:|.|||.|:...|| |.|||||||||:.||..
  Rat    46 DPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIK 110

  Fly   204 RKREERG--KGGYWELGVDPKKCD--------RKRIRNRKIFHP 237
            ..||..|  ||.||.|  || .|:        |:|.|.::.|.|
  Rat   111 VPREGGGERKGNYWTL--DP-ACEDMFEKGNYRRRRRMKRPFRP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 36/75 (48%)
Foxl2XP_003750619.1 FH 50..138 CDD:214627 40/90 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.