DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and slp1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster


Alignment Length:296 Identity:74/296 - (25%)
Similarity:113/296 - (38%) Gaps:97/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 TEPTHKSRVHDKQIKMFYSTRENTDKISHIILEANAQK-----SITKRPTASERFEI-FVNKIKR 127
            |||.|    |..|....||   |:|.      |.:|.:     |.|..|.:|....: ..|..|.
  Fly    32 TEPVH----HHHQYVHPYS---NSDG------ELSASEDFDSPSRTSTPMSSAAESLSSQNNDKL 83

  Fly   128 DLTEYEKLASKYETDV------------------TEKPPFNYSHIIGMAMLQN--GRITLQQLCS 172
            |:...::|..:.:.|.                  |:|||::|:.:|.||:..:  .|:||..:..
  Fly    84 DVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQ 148

  Fly   173 WIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN--RKREERGKGGYWELGVDPK-----------K 223
            ::..:|.:|:..|: |.|||||||||:.||..  |..::.|||.||.|  ||.           |
  Fly   149 YLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWIL--DPSAEEVFIGETTGK 211

  Fly   224 CDRK-----RIR----NRKIFHPTQNQT--------------------AKLQYEHLT-------- 251
            ..||     |.|    .:.||.|....:                    |...|:.:.        
  Fly   212 LRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAY 276

  Fly   252 ---EIQQAKSARKNHSRHIKKSKTSSLPETSEANIF 284
               :.|||..|..:.:.|  .::....|:...|.:|
  Fly   277 QQMQYQQAPQAHHHQAPH--PAQMQGYPQQLNAELF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 31/75 (41%)
slp1NP_476730.1 FH 120..205 CDD:214627 34/86 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.