DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxs1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001012091.1 Gene:Foxs1 / 311547 RGDID:1310679 Length:327 Species:Rattus norvegicus


Alignment Length:336 Identity:86/336 - (25%)
Similarity:131/336 - (38%) Gaps:96/336 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EKLASKYETDVTEKPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFR-VRKKWNNSIRHN 194
            |.||...|   ..|||::|..:|.||:..:  .|.||..:..:|..:|||:| .|..|.||||||
  Rat     8 ESLAPSTE---PSKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHN 69

  Fly   195 LSLHHCFRNRKREER--GKGGYWELGVDPKKCDRKR----IRNRKIFHPTQNQTAKLQYEHLTEI 253
            |||:.||....|::|  |||.||.|  ||...|..:    :|.|:            ::...|..
  Rat    70 LSLNECFVKVPRDDRKPGKGSYWTL--DPDCHDMFQHGSFLRRRR------------RFTKRTGA 120

  Fly   254 QQAKSARKNHSRHIK-KSKTSSLPETSEANIFNV---VPHKK-----------HNIADENDGQRQ 303
            |..|...|...|.:: .|.....|.|:...:...   ||:.|           :.....:|.:.|
  Rat   121 QGTKGPVKADHRPLRATSPDQGAPNTTTGRLCPFPPEVPNPKGFGGLMGSLPANMCPTTSDTRPQ 185

  Fly   304 LQTINKDDILKKKSELDTIVSSTESFLTESQNLNCFNSHKTDTTNTPISAEKNFCTFNNFYSEMT 368
            |.|..||....|        |.....|:|:            |:.:|..|    ..|::.:||..
  Rat   186 LPTGPKDMCSAK--------SGGPRELSEA------------TSPSPCPA----FGFSSAFSEAE 226

  Fly   369 PVLASNSNIVEDQNVSTDVSWPSHPCNI-TINYDYTNFQPIVDSIAEQFQCLHDSAGYDRNDDIL 432
            .:..:.:..|..:::.:     |:.|.: |:|:                 |:....|       |
  Rat   227 SLGKAPTPSVAPESIGS-----SYQCRMQTLNF-----------------CMGADPG-------L 262

  Fly   433 ENLLDVCV-TP 442
            |:||...| ||
  Rat   263 EHLLTSAVATP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 35/75 (47%)
Foxs1NP_001012091.1 Forkhead 18..103 CDD:278670 39/86 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.