DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxe3

DIOPT Version :10

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_056573.1 Gene:Foxe3 / 30923 MGIID:1353569 Length:288 Species:Mus musculus


Alignment Length:107 Identity:42/107 - (39%)
Similarity:57/107 - (53%) Gaps:17/107 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFR-VRKKWNNSIRHNLSLHHCFRNRKRE 207
            |||::|..:|.||:..  ..|:||..:..:|..:|||:| ..:||.|||||||:|:.||....||
Mouse    64 KPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPRE 128

  Fly   208 --ERGKGGYWELGVDPKKCD----------RKRIRNRKIFHP 237
              ..|||.||.|  ||...|          |||.:..::..|
Mouse   129 PGNPGKGNYWTL--DPAAADMFDNGSFLRRRKRFKRAELPAP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 Forkhead 146..217 CDD:459732 34/75 (45%)
Foxe3NP_056573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
FH_FOXE 64..152 CDD:410793 38/89 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..189 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.