DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxd3

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_571365.2 Gene:foxd3 / 30548 ZFINID:ZDB-GENE-980526-143 Length:371 Species:Danio rerio


Alignment Length:311 Identity:78/311 - (25%)
Similarity:117/311 - (37%) Gaps:101/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE 207
            |||::|..:|.||:||:  .::||..:|.:|..:|.::|.: ..|.|||||||||:.||....||
Zfish    96 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 160

  Fly   208 --ERGKGGYWELGVDPKKCDR----KRIRNRKIF------------------------------- 235
              ..|||.||.|  ||:..|.    ..:|.||.|                               
Zfish   161 PGNPGKGNYWTL--DPQSEDMFDNGSFLRRRKRFKRHQPDILRDQTALMMQSFGAYGIGNPYGRH 223

  Fly   236 ---HP-TQNQTAKLQYEHLTEI-----------QQAKSARKNHSRHIKKSKTSSLPETSEANIFN 285
               || .....|.|||.::..:           ..|:..||..|..:..|....|...|.|:|..
Zfish   224 YGIHPAAYTHPAALQYPYIPPVGPMLPPAVPLLPSAELNRKAFSSQLSPSLQLQLNSLSTASIIK 288

  Fly   286 VVPHKKHNIADEN-----DGQRQLQTINKDDILKKKSELDTIVSSTESFLTESQNLNCFNSHKTD 345
            ..|..:.:.:.||     ......||..:..:            :.:|.|..:|:|:        
Zfish   289 SEPSSRPSFSIENIIGVSSSSTSAQTFLRPPV------------TVQSALLSAQSLS-------- 333

  Fly   346 TTNTPISAEKNFCTFNNFYSEMTPVLASNSNIVEDQNVSTDVS-----WPS 391
            .|.|.              :.:.|:|:..|||:..|.:.|..:     |||
Zfish   334 LTRTS--------------AAIAPILSVPSNIISGQFLPTASTAAVSKWPS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 34/75 (45%)
foxd3NP_571365.2 Forkhead 96..182 CDD:278670 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.