DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxb1a

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_571360.1 Gene:foxb1a / 30542 ZFINID:ZDB-GENE-990616-47 Length:297 Species:Danio rerio


Alignment Length:166 Identity:47/166 - (28%)
Similarity:79/166 - (47%) Gaps:21/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EKPPFNYSHIIGMAM--LQNGRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRN--R 204
            :|||::|..:..||:  .....:.|.::..:|..:|.::|.. ::|.||:|||||.:.||..  |
Zfish    12 QKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPR 76

  Fly   205 KREERGKGGYWELGVDPKKCDR----KRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSAR--KNH 263
            :.::.|||.:|.|  .|...|.    ..:|.||.|       ..:..|||...:.:.:|.  :.|
Zfish    77 RPDQPGKGSFWAL--HPSCGDMFENGSFLRRRKRF-------KVMTSEHLAPSKPSDAAHYLQQH 132

  Fly   264 SRHIKKSKTSSLPETSEANIFNVVPHK-KHNIADEN 298
            ::....:..:.||:.|..|:....|.. ||..|.||
Zfish   133 AKLRLSALGTHLPQMSSYNLGVSQPSTFKHPFAIEN 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 25/75 (33%)
foxb1aNP_571360.1 FH 13..101 CDD:214627 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.