DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxa

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_571357.2 Gene:foxa / 30539 ZFINID:ZDB-GENE-990415-76 Length:355 Species:Danio rerio


Alignment Length:314 Identity:77/314 - (24%)
Similarity:128/314 - (40%) Gaps:77/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 EYEKLASKYETDVTE-KPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRV-RKKWNNSI 191
            |:::|.|.|...::. |||::|..:|.||:.|:  .|:||.::..||...|.::|. :::|.|||
Zfish    85 EFQELKSVYRRTLSHAKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSI 149

  Fly   192 RHNLSLHHCFRN--RKREERGKGGYWELGVD-----PKKCDRKRIRNRKIFHPT------QNQTA 243
            ||:||.:.||..  |..:..|||.||.|..|     ...|..:|.:..|....|      :.:..
Zfish   150 RHSLSFNDCFVRVPRSPDSPGKGSYWALHPDSGNMFENGCYMRRQKRFKCQKSTSTGKNSEGEDV 214

  Fly   244 KLQYEHLTEIQQAKSARKNHSRHIKKSKTS-SLPETSEANIFNVVPHKKHNIADENDGQRQLQTI 307
            |::.:...||:...|.:...|...|:|.|: |...|..|:..::.|  .|.:             
Zfish   215 KVEKKKKKEIKSVSSCKSPTSDATKQSSTTVSYANTKPASPSHLNP--SHTL------------- 264

  Fly   308 NKDDILKKKSELDTIVSSTESFLTESQ--NLNCFNSHKTDTTNTPISAEKNFCTFNNFYSEMTPV 370
                ...:..|:.|.:.|.......|.  :|:|    :..:.:.|||..:               
Zfish   265 ----FPTQPPEISTHLPSLSVPFPASMETSLHC----EPSSQHQPISVPR--------------- 306

  Fly   371 LASNSNIVEDQNVSTDVSWP------SH---PCNITINYDYTNFQ----PIVDS 411
                  :|:.|...|.||:|      ||   |...|.:..|..|.    |::.|
Zfish   307 ------LVDFQYCETPVSYPLYCQSNSHANFPSYTTDSVYYPGFSMCSTPLLSS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 31/75 (41%)
foxaNP_571357.2 FH 101..189 CDD:214627 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.