DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxd5

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_571345.1 Gene:foxd5 / 30524 ZFINID:ZDB-GENE-980605-4 Length:321 Species:Danio rerio


Alignment Length:254 Identity:73/254 - (28%)
Similarity:111/254 - (43%) Gaps:55/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SERFEIFVNKIKRDLTEYEKLAS----KYETDVTE-----------KPPFNYSHIIGMAMLQN-- 162
            ||| |.|:    ||.||.:...|    :.|:|...           |||::|..:|.||:||:  
Zfish    32 SER-EYFM----RDPTEVDHSGSESSGESESDFASSTVAPKQSSSVKPPYSYIALITMAILQSPM 91

  Fly   163 GRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE--ERGKGGYWELGVDPKKC 224
            .::||..:|.:|..||.:::.: ..|.|||||||||:.||....||  ..|||.||.|  ||...
Zfish    92 KKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWSL--DPASE 154

  Fly   225 D----------RKRIRNRK---------IFHPTQNQTAKLQYEHLTEIQQAKSARKNHSRHIKKS 270
            |          |||.:..:         ::|||.:..|   |.....:..|..|:.|...::...
Zfish   155 DMFDNGSFLRRRKRFKRNQPEFTKDSLVLYHPTLSYRA---YGRPYCVSGAVPAQTNPVGYLPVP 216

  Fly   271 KTSSLPET-SEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVSSTES 328
            ....:|.. .:....|:..|....|....:.:.|..:.:.|.|:.|.:|     ||::|
Zfish   217 DGIMVPPPFFQYQTMNIKIHDAPEIQQRPEHKTQRCSFSIDSIMAKSTE-----SSSKS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 34/75 (45%)
foxd5NP_571345.1 Forkhead 73..159 CDD:278670 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.