DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxi1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001099246.1 Gene:Foxi1 / 287185 RGDID:1307421 Length:372 Species:Rattus norvegicus


Alignment Length:266 Identity:73/266 - (27%)
Similarity:108/266 - (40%) Gaps:90/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAM--LQNGRITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN--RK 205
            :||::||.:|.||:  ..:.|:||.|:..::...|.|:...|. |.|||||||||:.||:.  |.
  Rat   117 RPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRD 181

  Fly   206 REERGKGGYWELGVDPKKCDR-------KRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNH 263
            .::.|||.||.|  || .|::       :|.|.||  ....:.|..|            ::.|..
  Rat   182 EDDPGKGNYWTL--DP-NCEKMFDNGNFRRKRKRK--SDASSSTGSL------------ASEKTE 229

  Fly   264 SRHIKKSKTSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVSSTES 328
            :|.:     ||.|:.:|.                   |..|.|.:.          ||..||.|.
  Rat   230 NRLL-----SSSPKPTEP-------------------QEVLDTASP----------DTTSSSPEK 260

  Fly   329 FLTESQN----LNCFNSHKTDTTN--TPISAE---------------KNFCTFNNFYSEMTPV-- 370
            ..:.:.:    ||.|.|..|...|  .|||..               :|...||::    ||:  
  Rat   261 RSSPAPSGTPCLNNFLSTMTAYVNGTNPISRSAATPGLSPEPVDKMGQNSLNFNSY----TPLTN 321

  Fly   371 LASNSN 376
            |:|:.|
  Rat   322 LSSHGN 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 32/75 (43%)
Foxi1NP_001099246.1 FH 117..205 CDD:214627 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.