DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxi2

DIOPT Version :10

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_899016.2 Gene:Foxi2 / 270004 MGIID:3028075 Length:311 Species:Mus musculus


Alignment Length:101 Identity:41/101 - (40%)
Similarity:60/101 - (59%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFF-RVRKKWNNSIRHNLSLHHCFRNRKR 206
            :||::||.:|.|| :|:.   |:||.|:..::...|.|: |.:..|.|||||||||:.||:...|
Mouse    99 RPPYSYSALIAMA-IQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPR 162

  Fly   207 EER--GKGGYWELGVDPKKCDR-------KRIRNRK 233
            :|.  |||.||.|  || .|::       :|.|.|:
Mouse   163 DENDPGKGNYWTL--DP-NCEKMFDNGNFRRKRRRR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 Forkhead 146..217 CDD:459732 34/76 (45%)
Foxi2NP_899016.2 FH_FOX 96..188 CDD:469596 38/92 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..237 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.