DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and fhl1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_594272.1 Gene:fhl1 / 2541552 PomBaseID:SPAC1142.08 Length:743 Species:Schizosaccharomyces pombe


Alignment Length:343 Identity:81/343 - (23%)
Similarity:128/343 - (37%) Gaps:107/343 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYH-FTSSAKQNVTLQSCKEENLLSL----------------EEEDSDEERELTNLNWLLRNQNL 49
            |:| .||:.::::.....|.|:.|.|                |..|:.....|.:||        
pombe   157 SFHTVTSNQEKDLLFSHIKHESDLPLGLSPADTNISNATSIIEHPDAANAHTLASLN-------- 213

  Fly    50 TWPKTIDYNPTEI--LNSKRNTEPTHKSRV--------------HDKQIKMFYSTRENTDKISHI 98
            ..||.:..:|:.|  |:.:....||...|.              ||:::|...|| ..:|.:.|.
pombe   214 QPPKHLTVSPSSIQRLSPQPYVRPTSDERPIETDSSVSAPKVANHDEELKQGKST-SPSDTVLHP 277

  Fly    99 ILEANAQKSITKRPTASERFEIFVNKIKRDLTEYEKLASKYETDVTEKPPFNYSHIIGMAML--Q 161
            .|..:....                                  |.|:||..:|:::|...::  .
pombe   278 DLNGSPDTG----------------------------------DATQKPNLSYANLIARTLIANP 308

  Fly   162 NGRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRN--RKREERGKGGYWELGVDPKK 223
            |.::||..:|.||...::::|.: ..|:|||||||||:..|..  |::.|.|||.:|.|  ||..
pombe   309 NKKMTLGDICEWIANNWSYYRHQPPAWHNSIRHNLSLNKAFIRIPRRQNEPGKGSFWML--DPSY 371

  Fly   224 CDRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKN-----HSRHIKKSKTSSL---PETSE 280
            .|:   .....|..|:..|..     .|......:||:|     .::.|...||..|   .|||.
pombe   372 IDQ---FEGNFFRRTKKPTPS-----ATPAAHPDTARENELAAIQTKGISAGKTEQLNPQKETSR 428

  Fly   281 ANIFNVVPHKKHNIADEN 298
            :        |.|....||
pombe   429 S--------KTHTSRGEN 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 28/75 (37%)
fhl1NP_594272.1 COG5025 1..564 CDD:227358 81/343 (24%)
FHA <38..119 CDD:238017
Forkhead 291..376 CDD:278670 32/89 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.