DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and fkh2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_596764.1 Gene:fkh2 / 2539703 PomBaseID:SPBC16G5.15c Length:642 Species:Schizosaccharomyces pombe


Alignment Length:474 Identity:106/474 - (22%)
Similarity:168/474 - (35%) Gaps:159/474 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RELTNLNWLLRNQNLTWPKTIDYN--PTEILNSKRNT------EPTHKSRVHDKQ-IKM---FYS 87
            ||..|.:...:|::|   :.||.|  |:::::.|...      :.|....|:.:. ||:   .:.
pombe   100 REPANPSPKGKNEDL---EVIDMNFGPSKVVSRKHAVVEYDLDDQTWNCSVYGRNGIKVDGKLFK 161

  Fly    88 TRENTDKISHIILEANAQKSITKRPTASERFEIFVNKIKRDLTEYEKLASKYETDVTE-----KP 147
            ..|.....|..|||....:.:...|.|:|:.:...:.||.|..:.|  .|....|..|     ||
pombe   162 NGETVKLTSGSILEVAGLQMMFVLPNAAEQKQTDESTIKEDAIKSE--ISAAVNDAAEYGDNKKP 224

  Fly   148 PFNYSHIIGMAMLQNGR--ITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN--RKRE 207
            |::||.:|..|:|.:..  :||..:.|||...:.::|..|. |.|||||||||:..||.  ||..
pombe   225 PYSYSVMIAQAILSSSECMMTLSNIYSWISTHYPYYRTTKSGWQNSIRHNLSLNKAFRKVPRKSG 289

  Fly   208 ERGKGGYWELGVDPKKCDRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHSRHIKKSKT 272
            |:|||..|.:                        ..:.:.|.:.:.:  |:.|       |:|.:
pombe   290 EQGKGMKWSI------------------------VPEFREEFIAKTR--KTPR-------KRSPS 321

  Fly   273 SSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVSSTESFLTESQNLN 337
            |.:|                .:|.:.:|...|..    .||.|..  ||.:.:.|.       .:
pombe   322 SPVP----------------LLAKKREGSPSLPI----PILPKMK--DTSIPAAEP-------AS 357

  Fly   338 CFNSHKTDTTNTP-----------ISAEKNFCTFNNFYSEMTPVLASNSNIVEDQNVSTDVS--- 388
            ...|.:..|.:||           .:.||...|:.      ||..|:.|:|:...:.:.|.:   
pombe   358 STTSARDQTPSTPKDVGSPSTAETSAEEKQMETYK------TPTHAALSDIISTHDYALDANSAS 416

  Fly   389 -----------------------------------WPS-----------HPCNITINYDYTNFQP 407
                                               ||.           :|.|..:.|.... |.
pombe   417 QTKKAAFGSPIGSSTYPTSSPAPFWKYVAVPNPHDWPQVGSYDTISPYRNPVNSHLIYSQIQ-QS 480

  Fly   408 IVDSIAEQFQCLHDSAGYD 426
            ....|.||   |||..|.|
pombe   481 SPKKIDEQ---LHDLQGVD 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 34/75 (45%)
fkh2NP_596764.1 COG5025 6..622 CDD:227358 106/474 (22%)
FHA 81..185 CDD:238017 19/87 (22%)
Forkhead 223..308 CDD:278670 35/108 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.