DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxi3

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001094934.1 Gene:Foxi3 / 232077 MGIID:3511278 Length:399 Species:Mus musculus


Alignment Length:228 Identity:61/228 - (26%)
Similarity:99/228 - (43%) Gaps:56/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LASKYETDVTEKPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFF-RVRKKWNNSIRHNL 195
            :||:.:.....:||::||.:|.|| :|:.   ::||..:..::...|.|: |.:..|.|||||||
Mouse   118 MASREDLMKMVRPPYSYSALIAMA-IQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNL 181

  Fly   196 SLHHCFRN--RKREERGKGGYWELGVDPKKCDR-------KRIRNRKIFHPTQNQTAKLQYEHLT 251
            ||:.||:.  |..::.|||.||.|  || .|::       :|.|.|:     ...::.|.....|
Mouse   182 SLNDCFKKVPRDEDDPGKGNYWTL--DP-NCEKMFDNGNFRRKRRRR-----AEASSNLTVPSGT 238

  Fly   252 EIQQAKSARKNHSRHIKKSKTSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKK 316
            ...:.:|:|...|..::....||:...|::             .:..:|.:              
Mouse   239 SKSEGQSSRLRVSGKLEGDSPSSILRPSQS-------------PEPPEGTK-------------- 276

  Fly   317 SELDTIVSSTESFLTESQNLNCFNSHKTDTTNT 349
               .|..|...|.||.:..||.|.|    |.||
Mouse   277 ---STASSPGASTLTSTPCLNTFLS----TFNT 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 31/76 (41%)
Foxi3NP_001094934.1 Forkhead 129..215 CDD:278670 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.