DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and FOXI1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_036320.2 Gene:FOXI1 / 2299 HGNCID:3815 Length:378 Species:Homo sapiens


Alignment Length:251 Identity:71/251 - (28%)
Similarity:96/251 - (38%) Gaps:84/251 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAM--LQNGRITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN--RK 205
            :||::||.:|.||:  ..:.|:||.|:..::...|.|:...|. |.|||||||||:.||:.  |.
Human   123 RPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRD 187

  Fly   206 REERGKGGYWELGVDPKKCDR-------KRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNH 263
            .::.|||.||.|  || .|::       :|.|.||  ....:.||.|..|               
Human   188 EDDPGKGNYWTL--DP-NCEKMFDNGNFRRKRKRK--SDVSSSTASLALE--------------- 232

  Fly   264 SRHIKKSKT-SSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVSSTE 327
                   || ||||..|.                        :|....|||...|...|..|..:
Human   233 -------KTESSLPVDSP------------------------KTTEPQDILDGASPGGTTSSPEK 266

  Fly   328 SFLTESQNLNCFNSHKTDTTN-------------TP-ISAE------KNFCTFNNF 363
            ..........|.||..:..|.             || :|.|      :|..|||:|
Human   267 RPSPPPSGAPCLNSFLSSMTAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 32/75 (43%)
FOXI1NP_036320.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
FH 123..211 CDD:214627 36/90 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..278 22/117 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.