DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32006 and FOXC1

DIOPT Version :9

Sequence 1:	NP_726538.1	Gene:	CG32006 / 317817	FlyBaseID:	FBgn0052006	Length:	443	Species:	Drosophila melanogaster
Sequence 2:	NP_001444.2	Gene:	FOXC1 / 2296	HGNCID:	3800	Length:	553	Species:	Homo sapiens

Alignment Length:	102	Identity:	42/102 - (41%)
Similarity:	59/102 - (57%)	Gaps:	17/102 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   146 KPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRNRKR 206
            |||::|..:|.|| :||.   :|||..:..:|..:|.|:|..|: |.|||||||||:.||....|
Human    78 KPPYSYIALITMA-IQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPR 141

  Fly   207 EER--GKGGYWELGVDPKKCD--------RKRIRNRK 233
            :::  |||.||.|  ||...:        |:|.|.:|
Human   142 DDKKPGKGSYWTL--DPDSYNMFENGSFLRRRRRFKK 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32006	NP_726538.1	FH	146..217	CDD:294049	35/76 (46%)
FOXC1	NP_001444.2	Required for transcriptional activation. /evidence=ECO:0000269\|PubMed:11782474	1..51
		FH	78..166	CDD:214627	38/90 (42%)
		Nuclear localization signal 1 (NLS 1). /evidence=ECO:0000269\|PubMed:11782474	78..93		7/15 (47%)
		Nuclear localization signal 2 (NLS 2). /evidence=ECO:0000269\|PubMed:11782474	168..176		3/7 (43%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	173..310		2/4 (50%)
		Required for transcriptional inhibition. /evidence=ECO:0000269\|PubMed:11782474	215..366
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	356..387
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	414..465
		Required for transcriptional activation. /evidence=ECO:0000269\|PubMed:11782474	466..553
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000010
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.910