DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and fkh-10

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_492676.2 Gene:fkh-10 / 182874 WormBaseID:WBGene00001442 Length:194 Species:Caenorhabditis elegans


Alignment Length:128 Identity:42/128 - (32%)
Similarity:64/128 - (50%) Gaps:17/128 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 FVNKIKRDLTE--YEKLASKYETDV---TE----KPPFNYSHIIGMAMLQN--GRITLQQLCSWI 174
            |::.....|.:  :..:...::|.:   ||    ||..:|..:|.||:|.:  .::.|.::..||
 Worm     8 FLSSSNHSLKDSPFPMIPLSFDTSIMSPTECQQPKPQHSYIGLIAMAILSSPQKKMVLAEVYEWI 72

  Fly   175 EAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKREERGKGGYWELGVDP---KKCDRKRIRNRK 233
            ..::.:||.| ..|.|||||||||:.||....|...|||.||  .|.|   |..:|...|.|:
 Worm    73 MNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGRAANGKGHYW--AVHPACVKDFERGDFRRRR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 31/73 (42%)
fkh-10NP_492676.2 Forkhead 41..125 CDD:365978 34/85 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.