DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and fkh-2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_508644.1 Gene:fkh-2 / 180663 WormBaseID:WBGene00001434 Length:270 Species:Caenorhabditis elegans


Alignment Length:211 Identity:54/211 - (25%)
Similarity:87/211 - (41%) Gaps:70/211 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NVTLQSCKEENLLSLEEEDSDEERELTNLNWLLRNQNLTWPKTIDYNPTEILNSKRNTEPTHKSR 76
            :::.|.|       :::|.:|.....|:::            |.|...|:.|             
 Worm    24 HISTQPC-------IKQESTDISDPSTSID------------TTDTMSTDYL------------- 56

  Fly    77 VHDKQIKMFYSTRENTDKISHIILEANAQKSITKRPTASERFEIFVNKIKRDLTEYEKLASKYET 141
             ||:.|         .|:.|...|..:     :|.|::|...|                  |..:
 Worm    57 -HDESI---------DDERSESTLSKD-----SKSPSSSNSEE------------------KTPS 88

  Fly   142 DVTEKPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN 203
            ...:||||:|:.:|.||:..:  .|:||..:..:|...:.|:|..|: |.|||||||||:.||..
 Worm    89 SPNDKPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVK 153

  Fly   204 --RKREERGKGGYWEL 217
              |..::.|||.||.|
 Worm   154 VPRNFDDPGKGNYWML 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/75 (44%)
fkh-2NP_508644.1 FH 93..170 CDD:238016 34/77 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.