DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and pes-1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001023406.1 Gene:pes-1 / 177267 WormBaseID:WBGene00003976 Length:264 Species:Caenorhabditis elegans


Alignment Length:158 Identity:42/158 - (26%)
Similarity:78/158 - (49%) Gaps:14/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ISHIILEANAQKSITKRPTASERFEIFVNKIKRDLTEYEKLASKYETDVTEKPPFNYSHIIGMAM 159
            ||.:.|:.::..|.:...:.:..|......:.:..:......|......|::|.::|:.:|.||:
 Worm    42 ISDLCLDLDSSTSSSCSVSPASSFHTRSESVGQQQSGRNSPVSSSTESPTKRPKYSYNALIAMAI 106

  Fly   160 LQN--GRITLQQLCSWIEAKFAFFRVRK--KWNNSIRHNLSLHHCFRNRKREERGKGGYW----E 216
            ..:  ..:.:.::..:|.:.|::::.:|  :|.||:|||||||..|| :.|...|||.||    :
 Worm   107 QSSPFKSLRVSEIYKYISSNFSYYKNQKPLQWQNSVRHNLSLHKEFR-KVRTLDGKGSYWAMTAD 170

  Fly   217 LGVD---PKKCDRKRIRNRKI--FHPTQ 239
            ||.|   ...|.:.|.:..|:  |.|.|
 Worm   171 LGTDVYISNNCGKLRRQKSKVAKFPPMQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 26/78 (33%)
pes-1NP_001023406.1 FH 93..168 CDD:238016 26/75 (35%)
rad23 <203..>240 CDD:273167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.