DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxd2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_032619.1 Gene:Foxd2 / 17301 MGIID:1347471 Length:492 Species:Mus musculus


Alignment Length:109 Identity:45/109 - (41%)
Similarity:61/109 - (55%) Gaps:19/109 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE 207
            |||::|..:|.||:||:  .|:||.::|.:|..:|.::|.: ..|.|||||||||:.||....||
Mouse   129 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 193

  Fly   208 --ERGKGGYWELGVDPKKCDR----KRIRNRKIF--------HP 237
              ..|||.||.|  ||:..|.    ..:|.||.|        ||
Mouse   194 PGNPGKGNYWTL--DPESADMFDNGSFLRRRKRFKRQPLPPPHP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 35/75 (47%)
Foxd2NP_032619.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..125
Forkhead 129..215 CDD:278670 39/87 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..344
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.