DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxc2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001095150.1 Gene:Foxc2 / 171356 RGDID:621703 Length:494 Species:Rattus norvegicus


Alignment Length:155 Identity:53/155 - (34%)
Similarity:77/155 - (49%) Gaps:27/155 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRNRKR 206
            |||::|..:|.|| :||.   :|||..:..:|..:|.|:|..|: |.|||||||||:.||....|
  Rat    71 KPPYSYIALITMA-IQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPR 134

  Fly   207 EER--GKGGYWELGVDPKKCDR----KRIRNRKIFHPTQNQTAKLQYEHLTE--IQQAKSA---- 259
            :::  |||.||.|  ||...:.    ..:|.|:.|........|.:..||.|  ...||.|    
  Rat   135 DDKKPGKGSYWTL--DPDSYNMFENGSFLRRRRRFKKKDVPKDKEERAHLKEPPPASAKGAPTGT 197

  Fly   260 ------RKNHSRHIKKSKTSS--LP 276
                  ::...:.:.||:.:|  ||
  Rat   198 PVADGPKEAEKKVVVKSEAASPALP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 35/76 (46%)
Foxc2NP_001095150.1 FH_FOXC1 66..158 CDD:410818 38/89 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..213 8/46 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..267
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.