DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxa3

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_032286.1 Gene:Foxa3 / 15377 MGIID:1347477 Length:353 Species:Mus musculus


Alignment Length:256 Identity:62/256 - (24%)
Similarity:107/256 - (41%) Gaps:56/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LTEYEKLASKYETDVTE-KPPFNYSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFRV-RKKWNN 189
            |...:::|..|...:.. |||::|..:|.||:.|  ...:||.::..||...|.::|. :::|.|
Mouse   101 LVHGKEMAKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQN 165

  Fly   190 SIRHNLSLHHCFRN--RKREERGKGGYWELGVDPKKCDRKRIRNRKIFHPTQNQTAK----LQYE 248
            ||||:||.:.||..  |..::.|||.||.|                  ||:.....:    |:.:
Mouse   166 SIRHSLSFNDCFVKVARSPDKPGKGSYWAL------------------HPSSGNMFENGCYLRRQ 212

  Fly   249 HLTEIQQAKSARKNHSRHIKKSKT--SSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDD 311
            ...:::: |:.:.|.:....::.|  |:...|:.|......|.:......|.:.|      :.||
Mouse   213 KRFKLEE-KAKKGNSATSASRNGTAGSATSATTTAATAVTSPAQPQPTPSEPEAQ------SGDD 270

  Fly   312 ILKKKSELD--TIVSSTESF----------LTESQNLN---CFNSHKTDTTNTPISAEKNF 357
            :    ..||  :..|||..|          |....|.|   ..|:..::.|:||...:..|
Mouse   271 V----GGLDCASPPSSTPYFSGLELPGELKLDAPYNFNHPFSINNLMSEQTSTPSKLDVGF 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 30/75 (40%)
Foxa3NP_032286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..83
FH 119..207 CDD:214627 33/105 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..287 16/78 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.