DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxg1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001153584.1 Gene:Foxg1 / 15228 MGIID:1347464 Length:481 Species:Mus musculus


Alignment Length:183 Identity:60/183 - (32%)
Similarity:87/183 - (47%) Gaps:36/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 EYEKLASKYETDVTEKPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRVRKK-WNNSIR 192
            |.:|...||     |||||:|:.:|.||:.|:  .|:||..:..:|...|.::|..|: |.||||
Mouse   163 EGDKKNGKY-----EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIR 222

  Fly   193 HNLSLHHCFRN--RKREERGKGGYWELGVDPKKCD------RKRIRNRKIFHPTQNQTAKLQYEH 249
            |||||:.||..  |..::.|||.||.|  ||...|      ..::|.|     :....|||.::.
Mouse   223 HNLSLNKCFVKVPRHYDDPGKGNYWML--DPSSDDVFIGGTTGKLRRR-----STTSRAKLAFKR 280

  Fly   250 --------LTEIQQAKSARKNHS-----RHIKKSKTSSLPETSEANIFNVVPH 289
                    ||.:.:|.|.....|     .|.:.|.|.|...|:.|...:.:|:
Mouse   281 GARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 34/75 (45%)
Foxg1NP_001153584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..173 4/14 (29%)
FH 173..261 CDD:214627 38/89 (43%)
Required for interaction with TLE6. /evidence=ECO:0000269|PubMed:16314515 241..336 26/100 (26%)
Interaction with KDM5B. /evidence=ECO:0000250 375..398
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..447
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.