DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxf2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_034355.2 Gene:Foxf2 / 14238 MGIID:1347479 Length:446 Species:Mus musculus


Alignment Length:82 Identity:34/82 - (41%)
Similarity:51/82 - (62%) Gaps:7/82 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EKPPFNYSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFR-VRKKWNNSIRHNLSLHHCFRNRKR 206
            ||||::|..:|.||:..  :.|:||.::..:::|:|.||| ..:.|.||:||||||:.||....:
Mouse    99 EKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPK 163

  Fly   207 --EERGKGGYWELGVDP 221
              ...|||.||.  :||
Mouse   164 GLGRPGKGHYWT--IDP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 31/75 (41%)
Foxf2NP_034355.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97
FH 100..188 CDD:214627 33/81 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..325
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.