DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxe1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_899121.1 Gene:Foxe1 / 110805 MGIID:1353500 Length:371 Species:Mus musculus


Alignment Length:99 Identity:42/99 - (42%)
Similarity:54/99 - (54%) Gaps:11/99 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE 207
            |||::|..:|.||:..  ..|:||..:..:|..:|.|:|.. |||.|||||||:|:.||....||
Mouse    55 KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPRE 119

  Fly   208 --ERGKGGYWELGVDPKKCDR----KRIRNRKIF 235
              ..|||.||.|  ||...|.    ..:|.||.|
Mouse   120 AGRPGKGNYWAL--DPNAEDMFESGSFLRRRKRF 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 34/75 (45%)
Foxe1NP_899121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..53
FH 55..143 CDD:214627 38/89 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.