DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxd4l1.2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_002935635.1 Gene:foxd4l1.2 / 100485983 XenbaseID:XB-GENE-876578 Length:338 Species:Xenopus tropicalis


Alignment Length:383 Identity:90/383 - (23%)
Similarity:140/383 - (36%) Gaps:118/383 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SDEERELTNLNWLLRNQNLTWPKTIDYNPTEILNSKRNTEPTHKSRVHDKQIKMFYSTRENTDKI 95
            ||||.|:..|.               .|.:..|....|.:||| |.:.|..: :..|....|:..
 Frog    20 SDEEDEIDILG---------------ENDSCNLRLHINQQPTH-SEIGDSGV-LSPSKLSGTENS 67

  Fly    96 SHIILEANAQKSITKRPTASERFEIFVNKIKRDLTEYEKLASKYETDVTEKPPFNYSHIIGMAML 160
            .|                :||..|...:|.....|...|.:..:     .|||::|..:|.||::
 Frog    68 CH----------------SSEEKEGGTSKDSLHTTPDSKASRAF-----LKPPYSYIALITMAIV 111

  Fly   161 QN--GRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE--ERGKGGYWELGVD 220
            |:  .::||..:|.:|.:||.:::.: ..|.|||||||||:.||....||  ..|||.||.|  |
 Frog   112 QSPYRKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTL--D 174

  Fly   221 PKKCDRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHSRHIKKS----------KTSSL 275
            |                    .:|..:::.:.:::.|..:::|...||..          ...|.
 Frog   175 P--------------------ASKDMFDNGSFLRRRKRFKRHHQELIKDGFLMYNPLHYITPYSA 219

  Fly   276 PETSEANIFNVVPHKKHNIADEN--------------DGQRQLQTINKDDILKKKSELDTIVSST 326
            |:|....|...:|   .|:|..|              |     |.:|:  :.|.:....|.....
 Frog   220 PQTQTPVICMAIP---QNLAMPNHLAPYPHKIKVPCPD-----QGVNR--VFKAQDNHHTASHHK 274

  Fly   327 ESFLTESQNLNCFNSHKTDTTNTPISAEKNFCTFNN-------FYSEMTPVLASNSNI 377
            .||..|            :....|...||:..:||.       ..|....:|.|.|:|
 Frog   275 CSFSIE------------NIMGEPKEPEKSLKSFNQNWNYNHLLQSSSACLLPSGSHI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/75 (44%)
foxd4l1.2XP_002935635.1 Forkhead 97..182 CDD:365978 37/106 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.