DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxg1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:138 Identity:53/138 - (38%)
Similarity:71/138 - (51%) Gaps:24/138 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EKLASKYETDVTEKPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRVRKK-WNNSIRHN 194
            ||...||     |||||:|:.:|.||:.|:  .|:||..:..:|...|.::|..|: |.||||||
 Frog   116 EKKNGKY-----EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHN 175

  Fly   195 LSLHHCFRN--RKREERGKGGYWELGVDPKKCDRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAK 257
            |||:.||..  |..::.|||.||.|  ||...|        :|  ....|.||:....|  .:||
 Frog   176 LSLNKCFVKVPRHYDDPGKGNYWML--DPSSDD--------VF--IGGTTGKLRRRSTT--SRAK 226

  Fly   258 SARKNHSR 265
            .|.|..:|
 Frog   227 LAFKRGAR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 34/75 (45%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 39/99 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.