DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxb1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001107970.1 Gene:foxb1 / 100125219 XenbaseID:XB-GENE-1018255 Length:322 Species:Xenopus tropicalis


Alignment Length:237 Identity:68/237 - (28%)
Similarity:104/237 - (43%) Gaps:49/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EKPPFNYSHIIGMAM--LQNGRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRN--R 204
            :|||::|..:..||:  .|...:.|.::..:|..:|.::|.. ::|.||:|||||.:.||..  |
 Frog    12 QKPPYSYISLTAMAIQSSQEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPR 76

  Fly   205 KREERGKGGYWELGVDPKKCD----------RKRIRNRKIFH--PTQNQTAKLQYEHLTEIQQAK 257
            :.::.|||.:|.|  .|...|          |||.:..|..|  |::...| .||..    ||||
 Frog    77 RPDQPGKGSFWAL--HPSCGDMFENGSFLRRRKRFKVMKSDHLAPSKASDA-AQYLQ----QQAK 134

  Fly   258 ---SARKNHSRHIKKSKTSSLPETSEANIFNVVPHKKHNIADEN--------DGQRQLQTIN-KD 310
               ||......|:.:..|.:| ..|:.:.|      ||..|.||        .|.....|:. ..
 Frog   135 LRLSALAASGTHLPQMSTYNL-GVSQTSSF------KHPFAIENIIAREYKMPGGLAFSTMQPMP 192

  Fly   311 DILKKKSELDTIVSSTESFLTESQNLNCFNSHKTDTTNTPIS 352
            ......::|.|:.||..:...     :.::|...||| ||||
 Frog   193 AAYPLHNQLTTVGSSIGTGWP-----HMYSSSMLDTT-TPIS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 26/75 (35%)
foxb1NP_001107970.1 FH 13..101 CDD:214627 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.