DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxf2

DIOPT Version :10

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001093702.1 Gene:foxf2 / 100101712 XenbaseID:XB-GENE-484646 Length:381 Species:Xenopus tropicalis


Alignment Length:338 Identity:76/338 - (22%)
Similarity:123/338 - (36%) Gaps:101/338 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EKPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFR-VRKKWNNSIRHNLSLHHCFRNRKR 206
            ||||::|..:|.||:..:  .|:||.::..:::|:|.||| ..:.|.||:||||||:.||....:
 Frog    61 EKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPK 125

  Fly   207 --EERGKGGYWELGVDPKK---CDRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHSRH 266
              ...|||.||.  :||..   .:....|.|......:.|..|..|..:..|             
 Frog   126 GLGRPGKGHYWT--IDPASEFMFEEGSFRRRPRGFRRKCQALKPMYRMMNGI------------- 175

  Fly   267 IKKSKTSSLPE-----------TSEANIFNV-------------------VPHKKHNIADENDGQ 301
              ...||.||:           |..:|.:|:                   |||     ...|.|.
 Frog   176 --GFSTSILPQGFDFQAPPASLTCHSNGYNLDMMSNSMAGGYDGLAGGHHVPH-----MSPNPGS 233

  Fly   302 RQLQTINKDDILKKKSELDTIVSSTESFLTESQN------------LNCFNSHKTDTTNTPISAE 354
            ..:.:..              |||:..:..:|.:            :.|.:.:.:.|.:...|..
 Frog   234 TYMASCP--------------VSSSGDYGPDSSSSPVPSSPAMASAMECHSPYTSPTAHWASSGA 284

  Fly   355 KNFCTFNNFYSEMTPVLASNSNIVEDQNVSTDVSWPSHPCNITINYDYTNFQPIVDSIAEQFQCL 419
            ..       |.:..|:..||.   ....:.|.||    |.::..:|.:.|.:..:.....::| .
 Frog   285 SP-------YLKQQPMPPSNG---ASAGIHTGVS----PYSLEQSYLHQNPREDLSVGLPRYQ-H 334

  Fly   420 HDSAGYDRNDDIL 432
            |.|...||.|.:|
 Frog   335 HSSPVCDRKDFVL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 Forkhead 146..217 CDD:459732 31/75 (41%)
foxf2NP_001093702.1 FH_FOXF1 63..161 CDD:410823 34/99 (34%)

Return to query results.
Submit another query.