DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxf2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001093702.1 Gene:foxf2 / 100101712 XenbaseID:XB-GENE-484646 Length:381 Species:Xenopus tropicalis


Alignment Length:338 Identity:76/338 - (22%)
Similarity:123/338 - (36%) Gaps:101/338 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EKPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFR-VRKKWNNSIRHNLSLHHCFRNRKR 206
            ||||::|..:|.||:..:  .|:||.::..:::|:|.||| ..:.|.||:||||||:.||....:
 Frog    61 EKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPK 125

  Fly   207 --EERGKGGYWELGVDPKK---CDRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHSRH 266
              ...|||.||.  :||..   .:....|.|......:.|..|..|..:..|             
 Frog   126 GLGRPGKGHYWT--IDPASEFMFEEGSFRRRPRGFRRKCQALKPMYRMMNGI------------- 175

  Fly   267 IKKSKTSSLPE-----------TSEANIFNV-------------------VPHKKHNIADENDGQ 301
              ...||.||:           |..:|.:|:                   |||     ...|.|.
 Frog   176 --GFSTSILPQGFDFQAPPASLTCHSNGYNLDMMSNSMAGGYDGLAGGHHVPH-----MSPNPGS 233

  Fly   302 RQLQTINKDDILKKKSELDTIVSSTESFLTESQN------------LNCFNSHKTDTTNTPISAE 354
            ..:.:..              |||:..:..:|.:            :.|.:.:.:.|.:...|..
 Frog   234 TYMASCP--------------VSSSGDYGPDSSSSPVPSSPAMASAMECHSPYTSPTAHWASSGA 284

  Fly   355 KNFCTFNNFYSEMTPVLASNSNIVEDQNVSTDVSWPSHPCNITINYDYTNFQPIVDSIAEQFQCL 419
            ..       |.:..|:..||.   ....:.|.||    |.::..:|.:.|.:..:.....::| .
 Frog   285 SP-------YLKQQPMPPSNG---ASAGIHTGVS----PYSLEQSYLHQNPREDLSVGLPRYQ-H 334

  Fly   420 HDSAGYDRNDDIL 432
            |.|...||.|.:|
 Frog   335 HSSPVCDRKDFVL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 31/75 (41%)
foxf2NP_001093702.1 Forkhead 61..147 CDD:365978 34/87 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.