DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxe1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_002936729.1 Gene:foxe1 / 100038190 XenbaseID:XB-GENE-478544 Length:377 Species:Xenopus tropicalis


Alignment Length:305 Identity:82/305 - (26%)
Similarity:122/305 - (40%) Gaps:82/305 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE 207
            |||::|..:|.||:..  :.::||..:..:|..:|.|:|.. |||.|||||||:|:.||....||
 Frog    66 KPPYSYIALIAMAIANSTDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPRE 130

  Fly   208 --ERGKGGYWELGVDPKKCDR----KRIRNRKIFHPTQNQTAKLQYEHLTE----IQQAKSARKN 262
              ..|||.||.|  ||...|.    ..:|.||.|..| :.|....|.|.|.    :|.|::...|
 Frog   131 PGRPGKGNYWAL--DPNAEDMFDSGSFLRRRKRFKRT-DLTTYPAYIHDTSMFSPLQVARATYPN 192

  Fly   263 -----------HSRHIKKSKTSSLPETSEA------NIFNVVPHKKHNIADENDGQRQLQTINKD 310
                       :|:.|....:...|.:|.|      .:|::      |....:.|....|..|: 
 Frog   193 TVYPNMTMSPSYSQQIAPHSSVYYPSSSPAFSSAQPRVFSI------NTLIGHSGSEHAQQPNR- 250

  Fly   311 DILKKKSELDTIVSSTESFLTESQNL--NCFNSHKTDTTNTPISAEKNFCTFNNFYSEMTPVLAS 373
                   .:...|:||.|   .|.|.  :.::|.....|..|.|        .|.||...|    
 Frog   251 -------SISPEVNSTSS---SSCNYGGSTYSSQAGSGTMLPRS--------TNPYSYSVP---- 293

  Fly   374 NSNIVEDQNVSTDVSWPSH-------------PCNITINYDYTNF 405
            ||::..:|:     |:|..             |.:..:|.|..:|
 Frog   294 NSHLQMNQS-----SYPHSNAQLFGSASRLPMPTSPPMNSDAVDF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/75 (44%)
foxe1XP_002936729.1 FH 66..154 CDD:214627 37/89 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.