DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxf2b

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_003200754.1 Gene:foxf2b / 100002904 ZFINID:ZDB-GENE-041001-130 Length:429 Species:Danio rerio


Alignment Length:345 Identity:81/345 - (23%)
Similarity:127/345 - (36%) Gaps:81/345 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 DLTEYEKLASKYETDV----TEKPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFFR-VR 184
            :|.|:..::...:|:.    .||||::|..:|.|| :|:.   |:||.::..:::.:|.||| ..
Zfish    89 NLEEHSAVSKSKKTNSGLRRPEKPPYSYIALIVMA-IQSAPTKRLTLSEIYQFLQTRFPFFRGSY 152

  Fly   185 KKWNNSIRHNLSLHHCFRNRKR--EERGKGGYWELGVDPKK---CDRKRIRNRKIFHPTQNQTAK 244
            :.|.||:||||||:.||....:  ...|||.||.  :||..   .:....|.|......:.|..|
Zfish   153 QGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWT--IDPTSEFMFEEGSFRRRPRGFRRKCQAMK 215

  Fly   245 LQYEHLT-------------EIQQAKSARKNHSRHIKKSKTSSLPET-SEANIFNVVPHKKHNIA 295
            ..|..:.             :.|....|...||.......:.|..|: |..:..::.|..:|...
Zfish   216 PMYRMMNGLGFGSAILPQSFDYQSPTGALACHSSGYNLDLSGSGYESISSGHHGHMSPSSRHGYM 280

  Fly   296 DE----NDGQRQLQTINKDDILKKKSELDTIVSSTESFLTESQNL-NCFNSHKTDTTNTPISAEK 355
            ..    .:|                   |..|.|..|.:..|..: .....|..           
Zfish   281 SSCPMPGNG-------------------DYAVESNTSPVPSSPAVAGALEGHSP----------- 315

  Fly   356 NFCTFNNFYSEMTPVLA-SNSNIVEDQNVSTDVSWPS--HPCNITINYDYTNFQPIVDSIAEQFQ 417
                    |||.|.:.| |||:.::..|..|..|.|:  ||...|.:.:....|......|:...
Zfish   316 --------YSESTALWASSNSSYLKQANTITSNSQPTGQHPGIFTYSLEQGYIQQSARDNADMSV 372

  Fly   418 CL-----HDSAGYDRNDDIL 432
            .|     |.|...:|.|.:|
Zfish   373 GLSRYPTHSSPVGERKDFML 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 31/76 (41%)
foxf2bXP_003200754.1 FH 111..199 CDD:214627 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.