DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anne and CG45063

DIOPT Version :9

Sequence 1:NP_001096849.1 Gene:anne / 317815 FlyBaseID:FBgn0052000 Length:1451 Species:Drosophila melanogaster
Sequence 2:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster


Alignment Length:264 Identity:62/264 - (23%)
Similarity:101/264 - (38%) Gaps:66/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 FKKCSSIRIFRCKQLVYAWNNNTNRFQRINGLDLNIPCSYYHQQRGLPVHE-------------- 327
            ||:.|..|...|:..........:..|..|.|.|.....|.|.   .|.||              
  Fly     5 FKRISKWRGRWCRSRRKKKEERESLQQTENELWLEYFSPYLHI---WPFHELCARLEANVSQGLT 66

  Fly   328 ------QISRRIVFGDNEITVPLR-DFKTLLFLE----VLNPFYVFQLFSVILWFTYDYYYYAC- 380
                  :::|.   |.|.:.:|.: :.:..:||:    :|.   :..|.|.|..|.. ||.:|. 
  Fly    67 SEAAGRKLARN---GKNVLPLPTKLELRPWIFLKSCFSILG---IIILLSSIASFAM-YYLFATK 124

  Fly   381 ---------------VILLMSVF--GITVSVLQTKKNQDVL-----QKTVYNTGNAWVVDHKGLS 423
                           :|||::.|  |:||. :|...::|:|     ...:|.|     |...|..
  Fly   125 TPDNGKVDPEFLVAGIILLVTFFLAGLTVQ-MQGDDDEDMLIAFDELMPMYCT-----VIRDGEK 183

  Fly   424 KELPTRAIVPGDIIEIPSSGCTLHCDAILISGNCI-LDESMLTGESVPVTKTPLPSKRDMIFDKT 487
            :.:.|:.:||||.:.| ..|..|..|....|...: |:...|||.|.|:..|||.::....:.:.
  Fly   184 EVIRTQDLVPGDTLPI-KYGQRLPADMRFFSTTGLELNNVALTGHSKPMHITPLANEGRQRYSRI 247

  Fly   488 EHAR 491
            |:.:
  Fly   248 EYIK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anneNP_001096849.1 P5-ATPase 158..291 CDD:289194 5/13 (38%)
P-ATPase-V 173..1355 CDD:273738 62/264 (23%)
E1-E2_ATPase 381..621 CDD:278548 34/119 (29%)
Cation_ATPase <758..813 CDD:289987
HAD_like <1087..1137 CDD:304363
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 15/79 (19%)
E1-E2_ATPase 140..>230 CDD:278548 29/96 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.