DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anne and LOC101885086

DIOPT Version :9

Sequence 1:NP_001096849.1 Gene:anne / 317815 FlyBaseID:FBgn0052000 Length:1451 Species:Drosophila melanogaster
Sequence 2:XP_005174520.3 Gene:LOC101885086 / 101885086 -ID:- Length:248 Species:Danio rerio


Alignment Length:221 Identity:127/221 - (57%)
Similarity:155/221 - (70%) Gaps:10/221 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 SKELPTRAIVPGDIIEIPSSGCTLHCDAILISGNCILDESMLTGESVPVTKTPLP--------SK 479
            ::|..:..:||||:|.|||:|..:.|||:||.|.||::||||||||||||||.||        |.
Zfish    23 TEEALSTDLVPGDVIVIPSNGTIMPCDAVLICGTCIVNESMLTGESVPVTKTDLPNPERDKKGSD 87

  Fly   480 RDMIFDKTEHARHTLFCGTKVIQTRYIGSKKVLAFVINTGNITAKGELIRSILYPPPVDYKFEQD 544
            .|.|:...||.||||||||.||||||...:.|.|.|:.||..||||:||||||||.|.|:|..:|
Zfish    88 GDQIYSTEEHKRHTLFCGTNVIQTRYYTGEMVKAVVVRTGFSTAKGQLIRSILYPKPTDFKLYRD 152

  Fly   545 SYKFIQFLAIIACVGFIYTLVTKILRGTDPVK-IAVESLDLITIVVPPALPAAMTVGRFYAQKRL 608
            :|.|:..|..:|.|.|||:||.||| ..:||| |.|:|||:|||.||||||||||.|..|||:||
Zfish   153 AYLFLLCLVAVASVVFIYSLVMKIL-NQEPVKEIIVKSLDIITITVPPALPAAMTAGIVYAQRRL 216

  Fly   609 KTSEIFCISPRSINVAGSINCCCFDK 634
            :...||.|||:.||:.|.:|..||||
Zfish   217 RKVGIFSISPQRINICGQLNLVCFDK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anneNP_001096849.1 P5-ATPase 158..291 CDD:289194
P-ATPase-V 173..1355 CDD:273738 127/221 (57%)
E1-E2_ATPase 381..621 CDD:278548 119/206 (58%)
Cation_ATPase <758..813 CDD:289987
HAD_like <1087..1137 CDD:304363
LOC101885086XP_005174520.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D172453at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.