DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sptr and NRE1

DIOPT Version :9

Sequence 1:NP_727265.1 Gene:Sptr / 31781 FlyBaseID:FBgn0014032 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:70/267 - (26%)
Similarity:117/267 - (43%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVTGASRGIGREFAQQLAKRIKAEGSMVTLLGRNQTLLQESKAE----IVATVPDLSVQTYSLE 69
            :||||.|||||:.....|....|  .::|..:.|::..|::.|.:    ....|.|::..:...:
Yeast     5 ILVTGVSRGIGKSIVDVLFSLDK--DTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDSVLKQ 67

  Fly    70 LETAKTEDFTKILEASGGKNNFERAIVIHNAGTVGDTSKRAKEIGDTDFLQRYYHSNVFSAISLN 134
            |..|..:...||            ..::.|||.: :..:...|| |.:..::.|..|.||.:|| 
Yeast    68 LVNAAVKGHGKI------------DSLVANAGVL-EPVQNVNEI-DVNAWKKLYDINFFSIVSL- 117

  Fly   135 CEFMRVFKGIPKL------VVNLSTLAAIAPISSMAHYCTVKAAREMYFRVLATEESAEDTLVLN 193
                 |...:|:|      ||.:|:.|.....||...|.:.|||...:...||.||.....:.: 
Yeast   118 -----VGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAV- 176

  Fly   194 YAPGVIDTQMTVQVQREAHDPAVVA-----MFREQRESKTMLTPAQTTERFIKV-LEAF-KFKSG 251
             |||::||.|.|.: ||...|:.::     |||..:|:..:|..:.....:.|: |... ...:|
Yeast   177 -APGIVDTDMQVNI-RENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNG 239

  Fly   252 DHVDYRD 258
            .::.|.|
Yeast   240 QYLSYND 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SptrNP_727265.1 sepiapter_red 7..258 CDD:273660 69/265 (26%)
adh_short 10..204 CDD:278532 55/203 (27%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 69/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.