DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sptr and dhrs4

DIOPT Version :9

Sequence 1:NP_727265.1 Gene:Sptr / 31781 FlyBaseID:FBgn0014032 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_956861.2 Gene:dhrs4 / 393539 ZFINID:ZDB-GENE-040426-1498 Length:276 Species:Danio rerio


Alignment Length:246 Identity:54/246 - (21%)
Similarity:96/246 - (39%) Gaps:55/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVTGASRGIGREFAQQLAKRIKAEGSMVTLLGRNQT-------LLQESKAEIVATVPDLSVQTYS 67
            :||.::.|||...|:.|.:|    |:.|.:..|.||       ||:....:::.|.         
Zfish    34 IVTASTDGIGLAAAEALGQR----GAHVVVSSRRQTNVDKAVSLLRSKNIKVIGTT--------- 85

  Fly    68 LELETAKTEDFTKIL----EASGGKNNFERAIVIHNAGT---VGDTSKRAKEIGDTDFLQRYYHS 125
              ....|.||..|::    |..||.:     |::.||..   .|:.....:|:.|.         
Zfish    86 --CNVGKAEDREKLINMTVEQCGGVD-----ILVSNAAVNPFFGNILDSTEEVWDK--------- 134

  Fly   126 NVFSAISLNCEFMRVFKGIPKL-------VVNLSTLAAIAPISSMAHYCTVKAAREMYFRVLATE 183
              ...:::...|:.....:|.:       ||.:|::|...|:.::..|...|.|.....|.||.|
Zfish   135 --ILGVNVKASFLLTKMVVPHIEKRGGGSVVIVSSVAGYQPMPALGPYSVSKTALLGLTRALAPE 197

  Fly   184 ESAEDTLVLNYAPGVIDTQMTVQVQREAHDPAVVAMFREQRESKTMLTPAQ 234
            .:..:..|...|||:|.|:.:..:.   .:..|:..|.:|...|.:..|.:
Zfish   198 LAQSNIRVNCVAPGIIKTRFSSALW---ENEGVLEEFLKQTSIKRLGQPEE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SptrNP_727265.1 sepiapter_red 7..258 CDD:273660 54/246 (22%)
adh_short 10..204 CDD:278532 49/214 (23%)
dhrs4NP_956861.2 CR_SDR_c 21..276 CDD:187641 54/246 (22%)
fabG 28..272 CDD:235975 54/246 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.