DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sptr and CG12116

DIOPT Version :9

Sequence 1:NP_727265.1 Gene:Sptr / 31781 FlyBaseID:FBgn0014032 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_572481.1 Gene:CG12116 / 31782 FlyBaseID:FBgn0030041 Length:273 Species:Drosophila melanogaster


Alignment Length:279 Identity:83/279 - (29%)
Similarity:138/279 - (49%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLKQRTYLLVTGASRGIGREFAQQLAKRIKAEGSMVTLLGRNQTLLQ--------ESKAE-IVA 56
            |||.:||:|:::|:|..:|:..|.:..:|: |.||:..:|..:|..|:        |.|.| :..
  Fly     6 MDLNRRTFLVLSGSSNPLGQSLALEFCRRL-ATGSLALILDEDQEQLRELENHLRSELKTENVKV 69

  Fly    57 TVPDL------SVQTYSLELETAKTEDFTKILEASGGKNNFERAIVIHNAGTVGDTSKRAKEIGD 115
            |:..|      .||.    :|.|..::|.    |......|||:|::||.|... |....:...|
  Fly    70 TIGKLDKDHSNGVQL----MEQALMDNFM----ADKDNQRFERSIILHNEGKAA-THMLLEPQSD 125

  Fly   116 TDFLQRYYHSNVFSAISLNCEFM--RVFKGIPKLVVNLSTLAAIAPISSMAHYCTVKAAREMYFR 178
            .|: :.|....:::.::||..::  :..:.:.||.||:::...:.|:......|:.|.||:||||
  Fly   126 DDW-KAYVQQQLYAPVALNQTWLQSKHLERVEKLAVNVTSSLMVRPLVHAGLLCSCKRARDMYFR 189

  Fly   179 VLATEESAEDTLVLNYAPGVIDT---QMTVQVQREAHDPA-VVAMFREQRESKTMLTPAQTTERF 239
            .:|.||......||:::||::||   |..|...|..  || ::|  .:|......:.|.|.|.:.
  Fly   190 AMAAEEYRFGVHVLSFSPGLMDTHEGQCDVNGNRIT--PADLIA--TKQLLQLPRIKPCQATLKL 250

  Fly   240 IKVLEAFKFKSGDHVDYRD 258
            |.:||...|.||..|||.|
  Fly   251 INILEEISFVSGHDVDYYD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SptrNP_727265.1 sepiapter_red 7..258 CDD:273660 78/271 (29%)
adh_short 10..204 CDD:278532 58/213 (27%)
CG12116NP_572481.1 FabG 6..>212 CDD:223959 61/216 (28%)
SPR-like_SDR_c 13..269 CDD:187625 77/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446744
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.92062 Normalized mean entropy S3233
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1089743at2759
OrthoFinder 1 1.000 - - FOG0004670
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44085
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.