DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sptr and Spr

DIOPT Version :9

Sequence 1:NP_727265.1 Gene:Sptr / 31781 FlyBaseID:FBgn0014032 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_062054.1 Gene:Spr / 29270 RGDID:3753 Length:262 Species:Rattus norvegicus


Alignment Length:253 Identity:81/253 - (32%)
Similarity:134/253 - (52%) Gaps:7/253 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVTGASRGIGREFAQQLAKRIKAEGSMVTLLGRNQTLLQESKAEIVATVPDLSVQTYSLELET-A 73
            ::||||||.||..|.||| .:.:.||::.|..|:.::|::.|.|:....|.|.|...:.:|.| :
  Rat    12 VLTGASRGFGRALAPQLA-GLLSPGSVLLLSARSDSMLRQLKEELCTQQPGLQVVLAAADLGTES 75

  Fly    74 KTEDFTKILEASGGKNNFERAIVIHNAGTVGDTSKRAKEIGDTDFLQRYYHSNVFSAISLNCEFM 138
            ..:.....:.........:|.::|:||||:||.||....|.|...:..|:..|:.|.:.|....:
  Rat    76 GVQQLLSAVRELPRPERLQRLLLINNAGTLGDVSKGFLNINDLAEVNNYWALNLTSMLCLTTGTL 140

  Fly   139 RVFK---GIPKLVVNLSTLAAIAPISSMAHYCTVKAAREMYFRVLATEESAEDTLVLNYAPGVID 200
            ..|.   |:.|.|||:|:|.|:.|......||..||||:|.::|||.||.:  ..||:||||.:|
  Rat   141 NAFSNSPGLSKTVVNISSLCALQPFKGWGLYCAGKAARDMLYQVLAVEEPS--VRVLSYAPGPLD 203

  Fly   201 TQMTVQVQREAHDPAVVAMFREQRESKTMLTPAQTTERFIKVLEAFKFKSGDHVDYRD 258
            |.|....:..:.||.:.:..::......::....:.::.:.:|:...|:||.|||:.|
  Rat   204 TNMQQLARETSMDPELRSRLQKLNSEGELVDCGTSAQKLLSLLQRDTFQSGAHVDFYD 261

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SptrNP_727265.1 sepiapter_red 7..258 CDD:273660 80/251 (32%)
adh_short 10..204 CDD:278532 70/197 (36%)
SprNP_062054.1 NADB_Rossmann 9..261 CDD:419666 80/251 (32%)