DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sptr and SPBC30D10.05c

DIOPT Version :9

Sequence 1:NP_727265.1 Gene:Sptr / 31781 FlyBaseID:FBgn0014032 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_596280.1 Gene:SPBC30D10.05c / 2540402 PomBaseID:SPBC30D10.05c Length:247 Species:Schizosaccharomyces pombe


Alignment Length:244 Identity:68/244 - (27%)
Similarity:106/244 - (43%) Gaps:54/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVTGASRGIGREFAQQLAKRIKAEGSMVTLLGRNQTLLQESKAEIVATVPDLSVQTYSLELETA 73
            :|:||:|:|||...|:.|.|:.|......:|....:|||.::        ||..|....      
pombe     9 ILLTGSSKGIGLATAEALQKKAKVIAVSRSLTPELETLLIQN--------PDSFVHVKG------ 59

  Fly    74 KTEDFTKILEASGGKNNFERAI--------VIHNAGTVGDTSKRAKEIGDTDF--LQRYYHSNVF 128
               |.|::     ||.:.|.||        ||.|||.:...:|    |.|.|.  .::.:..|.|
pombe    60 ---DVTEV-----GKASIETAIKKFGKLDSVILNAGVLEPIAK----IADADINEWRKLFDINFF 112

  Fly   129 SAISLNCEFMRVFKGIPKL------VVNLSTLAAIAPISSMAHYCTVKAAREMYFRVLATEESAE 187
            |.:.      .|...||.|      :|.:|:.||:....:.|.||..|||..|....|.:||  .
pombe   113 SVVE------TVKYAIPHLRKTKGTIVIVSSGAAVRVFPAWAAYCCSKAAINMLVMNLGSEE--P 169

  Fly   188 DTLVLNYAPGVIDTQMTVQVQREAHDPAVVA----MFREQRESKTMLTP 232
            |.:.:...|||:||.|.|.::.:::..|:..    .|:|.:.|..::.|
pombe   170 DIMSVAVRPGVVDTPMQVSIRNDSNKEAMGGDTHNFFKELKTSGQLVAP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SptrNP_727265.1 sepiapter_red 7..258 CDD:273660 68/244 (28%)
adh_short 10..204 CDD:278532 61/209 (29%)
SPBC30D10.05cNP_596280.1 adh_short 7..190 CDD:278532 63/214 (29%)
SPR-like_SDR_c 8..245 CDD:187625 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.