DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sptr and DHRS4

DIOPT Version :9

Sequence 1:NP_727265.1 Gene:Sptr / 31781 FlyBaseID:FBgn0014032 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_066284.2 Gene:DHRS4 / 10901 HGNCID:16985 Length:278 Species:Homo sapiens


Alignment Length:246 Identity:55/246 - (22%)
Similarity:100/246 - (40%) Gaps:62/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVTGASRGIGREFAQQLAKRIKAEGSMVTLLGRNQTLLQESKAEIVATVPDLSVQTYSLELETAK 74
            |||.::.|||  ||  :|:|:..:|:.|.:..|.    |::..:.|||:....:..........|
Human    36 LVTASTDGIG--FA--IARRLAQDGAHVVVSSRK----QQNVDQAVATLQGEGLSVTGTVCHVGK 92

  Fly    75 TEDFTKILEAS----GGKNNFERAIVIHNA------GTVGDTSKRAKEIGDTDFLQRYYHSNVFS 129
            .||..:::..:    ||.:     |::.||      |::.|.:   :|:.|...           
Human    93 AEDRERLVATAVKLHGGID-----ILVSNAAVNPFFGSIMDVT---EEVWDKTL----------- 138

  Fly   130 AISLNCEFMRVFKGIPKL-------VVNLSTLAAIAPISSMAHYCTVKAAREMYFRVLATEESAE 187
            .|::....:.....:|::       ||.:|::||.:|....:.|...|.|.....:.||.|.:..
Human   139 DINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPR 203

  Fly   188 DTLVLNYAPGVIDTQM----------------TVQVQR--EAHDPAVVAMF 220
            :..|...|||:|.|..                |::::|  |..|.|.:..|
Human   204 NIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SptrNP_727265.1 sepiapter_red 7..258 CDD:273660 55/246 (22%)
adh_short 10..204 CDD:278532 49/226 (22%)
DHRS4NP_066284.2 CR_SDR_c 23..278 CDD:187641 55/246 (22%)
fabG 30..273 CDD:235975 55/246 (22%)
Microbody targeting signal 276..278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.