DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sptr and DHRS2

DIOPT Version :9

Sequence 1:NP_727265.1 Gene:Sptr / 31781 FlyBaseID:FBgn0014032 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_878912.1 Gene:DHRS2 / 10202 HGNCID:18349 Length:300 Species:Homo sapiens


Alignment Length:206 Identity:56/206 - (27%)
Similarity:93/206 - (45%) Gaps:25/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVTGASRGIGREFAQQLAKRIKAEGSMVTLLGRNQTLLQESKAEIVATVPDLSVQTYSLELETAK 74
            :|||::.|||  ||  :|:|:..:|:.|.:..|.|..:..:.|::..  ..|||.  .:.....|
Human    40 VVTGSTSGIG--FA--IARRLARDGAHVVISSRKQQNVDRAMAKLQG--EGLSVA--GIVCHVGK 96

  Fly    75 TED----FTKILEASGGKNNFERAIVIHNAGT---VGDTSKRAKEIGDTDFLQRYYHSNVFSAIS 132
            .||    ..|.||..||.:     .::.:||.   ||.|...:::|.|     :....||.|...
Human    97 AEDREQLVAKALEHCGGVD-----FLVCSAGVNPLVGSTLGTSEQIWD-----KILSVNVKSPAL 151

  Fly   133 LNCEFMRVFKGIPKLVVNLSTLAAIAPISSMAHYCTVKAAREMYFRVLATEESAEDTLVLNYAPG 197
            |..:.:...:.....|:.:|::||..|:.::..|...|.|.....|.||.|.:.:|..|....||
Human   152 LLSQLLPYMENRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALELAPKDIRVNCVVPG 216

  Fly   198 VIDTQMTVQVQ 208
            :|.|..:..|:
Human   217 IIKTDFSKVVR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SptrNP_727265.1 sepiapter_red 7..258 CDD:273660 56/206 (27%)
adh_short 10..204 CDD:278532 55/200 (28%)
DHRS2NP_878912.1 SDR 27..>226 CDD:330230 55/203 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.