Sequence 1: | NP_727265.1 | Gene: | Sptr / 31781 | FlyBaseID: | FBgn0014032 | Length: | 261 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_878912.1 | Gene: | DHRS2 / 10202 | HGNCID: | 18349 | Length: | 300 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 56/206 - (27%) |
---|---|---|---|
Similarity: | 93/206 - (45%) | Gaps: | 25/206 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 LVTGASRGIGREFAQQLAKRIKAEGSMVTLLGRNQTLLQESKAEIVATVPDLSVQTYSLELETAK 74
Fly 75 TED----FTKILEASGGKNNFERAIVIHNAGT---VGDTSKRAKEIGDTDFLQRYYHSNVFSAIS 132
Fly 133 LNCEFMRVFKGIPKLVVNLSTLAAIAPISSMAHYCTVKAAREMYFRVLATEESAEDTLVLNYAPG 197
Fly 198 VIDTQMTVQVQ 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sptr | NP_727265.1 | sepiapter_red | 7..258 | CDD:273660 | 56/206 (27%) |
adh_short | 10..204 | CDD:278532 | 55/200 (28%) | ||
DHRS2 | NP_878912.1 | SDR | 27..>226 | CDD:330230 | 55/203 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2055 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |