DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPA1 and Rox8

DIOPT Version :10

Sequence 1:NP_112420.1 Gene:HNRNPA1 / 3178 HGNCID:5031 Length:372 Species:Homo sapiens
Sequence 2:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:240 Identity:57/240 - (23%)
Similarity:96/240 - (40%) Gaps:52/240 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     9 EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN 73
            :..|.:.|::|.|....:::.|.:.|...|.:..|.::|:|.   :..:.|:.|:..:....|:.
  Fly     2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG---NDPYAFIEYSNYQAATTALT 63

Human    74 A--------RPHKVDGRVV---EPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQ 127
            |        :..||:....   :||..:|        :|   ..||||.:..:.|...||:.|..
  Fly    64 AMNKRLFLEKEIKVNWATSPGNQPKTDIS--------SH---HHIFVGDLSPEIETETLREAFAP 117

Human   128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGH---------NCEVRKALSK 183
            :|:|....|:.|..:.|.:|:|||:|......:..:    ..:||.         |...||....
  Fly   118 FGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAI----QAMNGQWIGSRSIRTNWSTRKLPPP 178

Human   184 QEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGF 228
            :|.:.              |||:|||.||....|.|...|.|..|
  Fly   179 REPSK--------------GGGQGGGMGGGPGNGSGVKGSQRHTF 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPA1NP_112420.1 Globular A domain 4..94 19/95 (20%)
RRM1_hnRNPA1 12..92 CDD:410154 18/90 (20%)
Globular B domain 95..185 24/98 (24%)
RRM2_hnRNPA3 105..184 CDD:409996 23/87 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..216 9/33 (27%)
RNA-binding RGG-box 218..240 4/11 (36%)
HnRNPA1 312..344 CDD:463312
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..372
Nuclear targeting sequence (M9) 320..357
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788 15/73 (21%)
RRM2_TIA1_like 96..170 CDD:409789 20/77 (26%)
RRM_SF 221..292 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.