DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPA1 and tra2

DIOPT Version :10

Sequence 1:NP_112420.1 Gene:HNRNPA1 / 3178 HGNCID:5031 Length:372 Species:Homo sapiens
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:110 Identity:30/110 - (27%)
Similarity:48/110 - (43%) Gaps:25/110 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    85 EPKRAVSREDSQRPGAHLT------VKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSG 143
            ||:....|....|...|.:      .:.|.|.|:..:|.:|.:|:.|.:||.||.|:::.|..:.
  Fly    71 EPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQ 135

Human   144 KKRGFAFVTFDD-------HDS------------VDKIVIQKYHT 169
            :.|||.|:.|:.       .||            ||..:.|:.||
  Fly   136 RSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPA1NP_112420.1 Globular A domain 4..94 3/8 (38%)
RRM1_hnRNPA1 12..92 CDD:410154 2/6 (33%)
Globular B domain 95..185 27/100 (27%)
RRM2_hnRNPA3 105..184 CDD:409996 25/84 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..216
RNA-binding RGG-box 218..240
HnRNPA1 312..344 CDD:463312
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..372
Nuclear targeting sequence (M9) 320..357
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.