DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15347 and CG34040

DIOPT Version :9

Sequence 1:NP_001188562.1 Gene:CG15347 / 31779 FlyBaseID:FBgn0030040 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001033963.1 Gene:CG34040 / 3885655 FlyBaseID:FBgn0054040 Length:281 Species:Drosophila melanogaster


Alignment Length:195 Identity:50/195 - (25%)
Similarity:82/195 - (42%) Gaps:23/195 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ADGCIQCNSKDNERCATDPLSLLNRNCSDGSSNCYSRVLDG-YTIRGCAVDLDNATRNSC----- 92
            ::.||.|...:.:|.:.|    .:..||:....|.|....| ...:||...|::..|..|     
  Fly    23 SEKCIYCRDINCQRSSYD----ADEQCSEKLDACVSVFKAGVIQAQGCLESLEDDWREKCEDKDK 83

  Fly    93 NNELLCQLCTYSEGCNRNTFPLSRLMCLQCTGNSTSSSCA-TETYVSAKICPLYKFGDK-CYIRN 155
            .||:.|::|. :|.|  |.....|..|:|| .|:..:.|| :...::|..||:.:.|.. ||.  
  Fly    84 GNEIDCEICV-TERC--NNVAAKRTSCIQC-NNTEDAQCAESPGLLTAVQCPIARSGRSFCYA-- 142

  Fly   156 SNRTVDGSFQRGCLTSANARKQCVKDGNCYTC---EGRGCNFLLANDTNIPLARDSGAQLIISMT 217
              ..|....:|||..:.:.:.:|:.|.||:.|   |...||..:....:.|.......:...|.|
  Fly   143 --SLVGDDLKRGCSLTLSDQVKCLADPNCHLCDPLEQPHCNDQIVRADDSPTTTQEPTESTSSST 205

  Fly   218  217
              Fly   206  205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15347NP_001188562.1 DUF753 39..189 CDD:283175 42/160 (26%)
CG34040NP_001033963.1 DUF753 25..173 CDD:283175 43/159 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008554
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.