DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15347 and CG4377

DIOPT Version :9

Sequence 1:NP_001188562.1 Gene:CG15347 / 31779 FlyBaseID:FBgn0030040 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_611614.1 Gene:CG4377 / 37489 FlyBaseID:FBgn0034664 Length:231 Species:Drosophila melanogaster


Alignment Length:236 Identity:62/236 - (26%)
Similarity:98/236 - (41%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFYLLV---IAALSFLAYISCGMTQSKRSVPLAQFADGCIQCNSKDNERCATDPLSLLNRNCSDG 63
            ||.:|:   :|:......||..:..|..|.          :|.|.:...|:.........:|||.
  Fly     6 KFVILLALFLASREISGEISREVRNSAESP----------KCYSCEGINCSRTTRQNATVSCSDR 60

  Fly    64 SSNCYSRVLDGYTI--RGCAVDLDNATRNSC-NNELLCQLCTYSEGCN---RNTFPLSRLMCLQC 122
            ...|.: :.:.:.:  |||...:..|.:..| ..:..||.|: .:.||   |..|     .|:||
  Fly    61 LDVCVT-IYEDFAVSERGCFSQISLAGQAKCAAKDDQCQKCS-GQLCNNVGRRDF-----KCIQC 118

  Fly   123 TGNSTSSSC---ATETYVSAKICPLYKFGDK-CYIRNSNRTVDGSFQRGCLTSANARKQCVKDGN 183
            .| |.|:.|   ||.: ::|..|.|....:. ||::......| |.||||..|...:|.|::|..
  Fly   119 IG-SDSADCNKGATAS-LAATQCALPTSANSYCYVKVVGDQKD-SLQRGCALSVKEQKACLEDSK 180

  Fly   184 CYTC-EGRGCNFLLANDTNIPLARDSGAQLIISMTLLISGL 223
            |..| .....:.:..|:.::.|...|.|:.  |..||..||
  Fly   181 CSLCLPENSSDSVACNNYDLELGPKSSAEQ--SKKLLSYGL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15347NP_001188562.1 DUF753 39..189 CDD:283175 45/160 (28%)
CG4377NP_611614.1 DUF753 36..184 CDD:283175 44/157 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008554
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.