DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15347 and CG13492

DIOPT Version :9

Sequence 1:NP_001188562.1 Gene:CG15347 / 31779 FlyBaseID:FBgn0030040 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_726121.3 Gene:CG13492 / 37487 FlyBaseID:FBgn0034662 Length:2979 Species:Drosophila melanogaster


Alignment Length:237 Identity:60/237 - (25%)
Similarity:105/237 - (44%) Gaps:47/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISCGMTQSKRSVPLAQFADG----------------------CIQCNSKDNERCATDPLSLLNR- 58
            :.|..:|::.|  |.|:.:|                      |:.|:|.....||.||.::|.. 
  Fly  2759 MGCASSQNESS--LEQWQEGNLLYSCQGSECNELSRLPTEGECLSCDSSKTLECAQDPTAVLTTI 2821

  Fly    59 NCSDGSSNCYSRVLDGYTIRGCAVDLDNATRNSCNNELLCQLCTYSEGCNRNTFPLSRLMCLQCT 123
            .|...:|:|.:|:.:|:|.|||..::.:...:||..:..|..|:.:: ||...||.:|..|..| 
  Fly  2822 TCHAPNSDCITRLENGHTHRGCRSEVSSTESSSCVADGTCSACSGAK-CNVEIFPNNRRRCYIC- 2884

  Fly   124 GNSTSSSCATETYVSAKICPLYKFGDKCYIRNSNRTVDGSFQRGCLTSANARKQCVKDG--NCYT 186
             ||.......:...|..:||:|...|:|....:|    |..:|||.:..    :|..|.  :|..
  Fly  2885 -NSIDDPLCAQHPSSLAVCPIYAANDECVTSLNN----GLLRRGCASEL----ECEIDNEDHCNK 2940

  Fly   187 CEGRGCNFLLANDTNIPLARDSG--AQLIISMTLLISGLVAA 226
            |...|||       .|.|...:|  :.:.:.:||:::.|:::
  Fly  2941 CSTDGCN-------TIELTGSAGGLSGMGLGLTLIVAWLISS 2975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15347NP_001188562.1 DUF753 39..189 CDD:283175 44/152 (29%)
CG13492NP_726121.3 DUF753 112..263 CDD:283175
DUF753 281..428 CDD:283175
DUF753 368..520 CDD:283175
DUF753 537..674 CDD:283175
DUF753 700..844 CDD:283175
DUF753 871..>965 CDD:283175
DUF753 956..1104 CDD:283175
DUF753 1122..1266 CDD:283175
DUF753 1206..1336 CDD:283175
DUF753 1376..1523 CDD:283175
DUF753 1540..1690 CDD:283175
DUF753 1721..>1811 CDD:283175
DUF753 1797..1948 CDD:283175
DUF753 1966..2110 CDD:283175
DUF753 2051..2191 CDD:283175
DUF753 2220..2368 CDD:283175
DUF753 2384..2530 CDD:283175
DUF753 2640..2769 CDD:283175 2/9 (22%)
DUF753 2801..2943 CDD:283175 44/152 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455219
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F712
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D25716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.