DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment org-1 and EOMES

DIOPT Version :9

Sequence 1:NP_001285019.1 Gene:org-1 / 31778 FlyBaseID:FBgn0021767 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001265111.1 Gene:EOMES / 8320 HGNCID:3372 Length:705 Species:Homo sapiens


Alignment Length:508 Identity:156/508 - (30%)
Similarity:210/508 - (41%) Gaps:122/508 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EQIDAKLADIETHSTGSTGTAN-SNSSTSS----ISNPS---------C---PDQSSSSSSSSVS 118
            |::.:..|.....:..:..||. |..|.||    :.:|.         |   |.|:::.:.....
Human   112 EELPSAAAAAAAAAAAAAATARYSMDSLSSERYYLQSPGPQGSELAAPCSLFPYQAAAGAPHGPV 176

  Fly   119 LPTDYAGVHSEASMAPTAG--------GTAVTTTSAGGVSASTASKKFKGQHKKDNNSAENGTVK 175
            .|......:...||.|..|        |.|.....||..|.:..|              ..|...
Human   177 YPAPNGARYPYGSMLPPGGFPAAVCPPGRAQFGPGAGAGSGAGGS--------------SGGGGG 227

  Fly   176 PNSHNISKGESEPV---HPSLA------------------QAIVVLETKALWDQFHAQGTEMIIT 219
            |.::..|:|  .|:   :|..|                  :|.|.|..:.||.:||...||||||
Human   228 PGTYQYSQG--APLYGPYPGAAAAGSCGGLGGLGVPGSGFRAHVYLCNRPLWLKFHRHQTEMIIT 290

  Fly   220 KTGRRMFPTFQVRIGGLDPHATYICMMDFVPMDDKRYRYAFHNSCWVVAGKAD-PISPPRIHVHP 283
            |.||||||.....|.||:|.|.|...::.|..|...:|  |....||..|||| .:...:::|||
Human   291 KQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADPNHWR--FQGGKWVTCGKADNNMQGNKMYVHP 353

  Fly   284 DSPAVGSNWMKQIVSFDKLKLTNNQLDENGH---IILNSMHRYQPRFHLVYLPPKNASLDENEHS 345
            :||..||:||:|.:||.|||||||:...|.:   |:|.|:|:||||.|:|.:...... |.|| .
Human   354 ESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQSLHKYQPRLHIVEVTEDGVE-DLNE-P 416

  Fly   346 SHFRTFIFPETSFTAVTAYQNQRVTQLKISSNPFAKGFRDD-------GTND------------- 390
            |..:||.|.||.|.|||||||..:|||||..|||||||||:       ..||             
Human   417 SKTQTFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDSMYTASENDRLTPSPTDSPRSH 481

  Fly   391 -VTTGGGSSMSSMSHE------SQARMKQQQQQQQQQQQQLQQQQQQQQQLKERTAATSNFGLSC 448
             :..||...:.|...|      .|||....::...|....|..||.:                  
Human   482 QIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSE------------------ 528

  Fly   449 SELAIEQQQ---QQQQQQGVLQLPATPSSSSTSGNSPDLLGYQMEQ-QLQQQH 497
             |:|...|:   ...||.|..:|..  ||..:...|..||.|.::. .||..|
Human   529 -EVANPPQRWLVTPVQQPGTNKLDI--SSYESEYTSSTLLPYGIKSLPLQTSH 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
org-1NP_001285019.1 TBOX 195..389 CDD:238106 97/204 (48%)
EOMESNP_001265111.1 TBOX 267..460 CDD:238106 97/196 (49%)
T-box_assoc 482..703 CDD:292794 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.