DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment org-1 and tbx-43

DIOPT Version :9

Sequence 1:NP_001285019.1 Gene:org-1 / 31778 FlyBaseID:FBgn0021767 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001040883.1 Gene:tbx-43 / 4363053 WormBaseID:WBGene00044798 Length:305 Species:Caenorhabditis elegans


Alignment Length:218 Identity:68/218 - (31%)
Similarity:110/218 - (50%) Gaps:21/218 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 QAIVVLETKALWDQFHAQGTEMIITKTGRRMFPTFQVRIGGLDPHATYICMMDFVPMDDKRYRYA 259
            |..|.|..|:||.:|.:|..||||||.||.:||..:....||..|..|...:...|:..::.:: 
 Worm     2 QCHVALMEKSLWREFDSQCNEMIITKIGRNLFPILEFAFKGLCEHLNYKIGVTMEPISYQKLKF- 65

  Fly   260 FHNSCWVVAGKADPISPPRIHVHPDSPAV---GSNWMKQIVSFDKLKLTNNQ--LDENGHII-LN 318
                   .||:.:.:......|.|:...:   |...:::.:..:||||||::  |.::..:| :.
 Worm    66 -------TAGRWESLDIQEEMVQPNEVFLMKSGRELLQRGLKLEKLKLTNSKDALQKSDQMIRVQ 123

  Fly   319 SMHRYQPRFHLVYLPPKNASLDENEHSSHFRTFIFPETSFTAVTAYQNQRVTQLKISSNPFAKGF 383
            ||.:|.|..::..:.|..|       .:....|.||||.|.||||||::.|.|||:..|.||:||
 Worm   124 SMRQYMPVLNIYEISPVGA-------HNQIGKFQFPETKFIAVTAYQSELVKQLKVQKNKFAQGF 181

  Fly   384 RDDGTNDVTTGGGSSMSSMSHES 406
            |:...::.|:.....:|:.|..|
 Worm   182 RESIKSNATSSTKRPLSTTSSNS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
org-1NP_001285019.1 TBOX 195..389 CDD:238106 64/199 (32%)
tbx-43NP_001040883.1 T-box 5..183 CDD:279278 62/192 (32%)
Ashwin <170..>221 CDD:291969 12/35 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.